DPCstruct | MC7283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 17.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.60 |
| Pfam Score | 99.17 |
| Assigned Pfam label(s) | PF01237- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7YKB9 | 34-117 | GSMPTNYELYYGFTRFAIELNELDPVLKDLLPPTDARFRPDQRFLEEGNVEAAATEKQRVEELQRSRRRYMEENNLEHIPKFFK |
| H2XWG3 | 9-105 | YGFSKFAIQLNELLEHERKVLPHTDTRFRPDQRLLEVGDVDGAEMEKQRVEQIQRDQKRLRDANNIEYLPKYFKKVSSGNTESWMFI… |
| M4CED6 | 219-363 | None |
| A0A836ANZ0 | 77-173 | None |
| A0A0M3IF99 | 2-106 | None |
| A0A1U8FG26 | 891-1003 | None |
| G0PNT0 | 94-170 | None |
| A0A067RRW2 | 847-958 | None |
| A0A2G8LCJ6 | 56-172 | None |
| A0A7R9Q4Q9 | 121-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.