DPCstruct | MC7280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 148 ± 22 aa |
| Standard deviation of domain lengths | 21.86 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 26.92 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | PF10171- PF10419 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674KHA7 | 19-185 | WCKSLLQDYADACRDVALGFKERPGKAGLYLSLLAGATVCSLHVPCDASFESSLLEASGTLLLLSPWIRNGSSEGHVQRLMKLQNQG… |
| H2XT55 | 20-170 | SIKRTVDDYKAAASDTAENIKSRPARSLLNTAAFCGAIYLYKTVPEEQNFHASLVEASNDLLLVGDAIRNPVPDNHVQKIMQYTTKG… |
| A0A4W5RT99 | 39-206 | None |
| A0A834KLK9 | 46-204 | None |
| A0A3P8I7S4 | 7-167 | None |
| A0A402FPQ2 | 3-147 | None |
| A0A183VJQ7 | 24-166 | None |
| A0A0N5AL18 | 209-367 | None |
| A0A4U1FPJ5 | 62-184 | None |
| A0A0D8XX40 | 3-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.