DPCstruct | MC728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 125 |
|---|---|
| Mean domain length (aa) | 143 ± 29 aa |
| Standard deviation of domain lengths | 29.34 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1M9Q5 | 4-134 | EQFSHDTALVLGQILIDLAKKGRKSIAVQISKNGQKLFYHAMDGTSPDQEHWIRRKSNVTARHNHSSYYIRLYNESKNRSYFEAFSV… |
| A0A7S1BMV4 | 7-161 | SATLTLKSADAIANGAIDAVGTLSKKSPISVTVVDSAGSVIVQKRMDGSPPGAYLRFSLAKARSCVYLETSSRNFREKYTSDATQPA… |
| A0A7V3UHL3 | 27-249 | None |
| A0A258VDI6 | 388-526 | None |
| A0A485J994 | 410-537 | None |
| I5CZP4 | 2-104 | None |
| A0A7D7C2G4 | 135-269 | None |
| A0A812LI98 | 56-223 | None |
| A0A194XTG1 | 152-306 | None |
| A0A7W9X179 | 579-718 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.