DPCstruct | MC7275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 220 ± 29 aa |
| Standard deviation of domain lengths | 29.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183DZG6 | 2-210 | VQALKFKCDMNEHNYMTIVDLILQDAGENVSEEIADDQVRAQYNTAACDAVRPHLFDIIEFISDLHVLTKVKKITNLDNIGGDIKSS… |
| H2XMW4 | 72-286 | DRDKLFITRLAIAKLIASLKLSCSISECNLLLLLQFVLLDSGSSVNPRTMFHFLSMKVLSKSKGPSYAMECMKGHLSDCLDILSDEQ… |
| A0A817L482 | 102-351 | None |
| A0A833VLG2 | 2-294 | None |
| A0A8B6BZP8 | 427-674 | None |
| A0A3P7G0R1 | 5-196 | None |
| A0A5E4C052 | 162-369 | None |
| A0A0L8FRX5 | 623-811 | None |
| A0A0N4UA33 | 1579-1765 | None |
| A0A077YX75 | 1875-2102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.