DPCstruct | MC7274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 10.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2Y6U9 | 33-145 | RADAACLDKGGQCKDFRTNKCELGYEQFLCSGSGENRCCFECSPDDDTCNAEVDDWNNGDSPCESANYGICQYNSNYCPSNVYETNK… |
| H2XKE3 | 118-207 | EKDESCENIYGTCQLDTVTCDGVWGEATCGGPANRKCCSPGAEAIRSWIKNDDQCLEVLGVCQLATTSCDGPFQSKTCGGPAQRQCC… |
| F6YJQ4 | 2-117 | None |
| F6X2X2 | 113-210 | None |
| F6VZ88 | 2-112 | None |
| F6PS12 | 144-253 | None |
| A0A3Q9DBI9 | 13-118 | None |
| A0A6P4Y7E9 | 363-474 | None |
| A0A6P4Y725 | 371-467 | None |
| A0A1S3IU05 | 9-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.