DPCstruct | MC7272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 138 ± 15 aa |
| Standard deviation of domain lengths | 14.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226PH66 | 166-325 | GSPLYLHIGEVIDGVDMRAEVGLLTRNILIQGEMEDSCYGENQCQFFSFDTFGGHIKILANFSSVHMSGVELKNMGQQILGSYPVHF… |
| F7BIJ2 | 2-151 | KTIGLNSALEYRHMGETYSVNGFRLEMRAEVALLTHNIKIVGELYDTIDKEAFGGRVLVGSTSSSSGDPLTGWARISNVEFLRAGQE… |
| A0A819LDI9 | 273-413 | None |
| A0A4W5PAA9 | 1-135 | None |
| A0A5A9NKE5 | 365-498 | None |
| A0A4Q3HFD5 | 238-337 | None |
| A0D607 | 1-126 | None |
| Q2SGK2 | 1-128 | None |
| A0A6G1RJZ4 | 23-181 | None |
| A0A6J8AD86 | 210-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.