DPCstruct | MC7271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 106 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19742 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6AU45 | 2-95 | TLLPPTLAPRDALHLLSALRDLHARQLLAFVPVTTWGWQDDTLLALALQRQARFEQDGTLYEAWSYDIRTYKAVPDWLNPRFWANPD… |
| A0A4P0TE21 | 20-129 | ELPAELASQRFDLALFVDCLEHLPQRRGLQLLAGVRNLNASRVAVLVDLGASDWNETDFFALAMQNSERFQREGQTLTLFTYDLHEY… |
| A0A191ZF43 | 83-195 | None |
| A0A401JAF2 | 1-89 | None |
| A0A2Z2NZH3 | 60-168 | None |
| A0A855HID6 | 10-109 | None |
| A0A3D5SDG7 | 11-128 | None |
| A0A426QNZ2 | 15-109 | None |
| A0A1H2SHF2 | 236-340 | None |
| A0A7J6Z4P6 | 47-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.