DPCstruct | MC727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6QIR8 | 1-72 | MSSASSSAAAANAGEGSGGAEEGVEITYVSYGGEQHLPLVMSLVDEELSEPYSIFTYRYFVYLWPQLTFLQL |
| A0A7S1BH02 | 1-101 | IGSRGTKRAPGRTQYIEMTIQQNMEEISIEGVKAYDGGRDSIALPSRDDNTPTKTTFVDYAGEQDIPTLMSLVDRDLSEPYSIFTYR… |
| A0A1B0GPM5 | 120-208 | None |
| A0A6I8PMG3 | 116-187 | None |
| A0A1W0A0Y5 | 824-918 | None |
| A0A4Y7M5S4 | 279-356 | None |
| H2Z7V3 | 103-205 | None |
| A0A7R9LE36 | 1-100 | None |
| A0A212CUF6 | 140-243 | None |
| A0A2G8KGR2 | 233-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.