DPCstruct | MC7269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 9.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0VFZ4 | 335-423 | IETLRPRDWLGFADIPAEMFLILPAAQQFAEKYHAYTLTRADRPNSRVRDLVDMLLLIRRADLPPERVRKALRATFARRGSHPIPKT… |
| A0A838D3Z3 | 1-114 | MAAPDLLDFAGIEPARIPAVPLEQRLAEMLHAYTRSYGRGHPSSRRKDLIDLVLISELADFDDAQPLDGAIRKVFARRATHALPASL… |
| A0A6N7IKX3 | 29-144 | None |
| A0A2W5ZZ49 | 147-241 | None |
| A0A521UG04 | 1-93 | None |
| A0A7V9N5Z6 | 92-182 | None |
| A0A2A4TE82 | 91-185 | None |
| A0A315XM50 | 238-329 | None |
| A0A7C2TDL5 | 13-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.