DPCstruct | MC7268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 264 ± 34 aa |
| Standard deviation of domain lengths | 33.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 25.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q4SPZ7 | 26-281 | AAKRPTRAEQEKARRTGNARTSREHLRTIVRTAVSAATTAAELFQIIEGTGALVDVQYFPSGDVRGYKVALSHDTNAQGEPVWFSGS… |
| A0A7W1M6G9 | 8-291 | PRETLARAVRACASASADEAEFVRRLRRSGVRARPRYAAGRGDVVSGYSVALRPPKGEAPIWYSGGQLARDLTLPRLRAGWPDSPQG… |
| A0A5C4XUF5 | 148-419 | None |
| A0A2D9NSQ4 | 66-364 | None |
| A0A4R1F6B2 | 230-545 | None |
| A0A1C5BKU9 | 198-515 | None |
| A0A3D5DZ52 | 225-460 | None |
| A0A1Y2NCT1 | 2-225 | None |
| A0A1A0JQ19 | 234-552 | None |
| A0A853DII0 | 228-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.