DPCstruct | MC7266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 158 ± 13 aa |
| Standard deviation of domain lengths | 12.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8CK07 | 1-160 | MWKETSQYMTAATSVSIDDIVAHLLESGIIELGSDPNAIVAAKNLVFAVIGWQTMLYQADMHSCPPEQLAIQSEMGAHQGVAHLCLK… |
| G9MYL4 | 67-210 | LGKWDSLIDQEYILHEQPFEKIVQLCYEVADVLREHGAISINKIVQKMQGKKIIRVDTDQSYDSYGLIFSILGWLSLLYIPAIQDQS… |
| A0A1S7ULI6 | 67-225 | None |
| A0A1B8G3Y5 | 1-158 | None |
| A0A3A2ZI96 | 1-167 | None |
| A0A6A6DR68 | 109-246 | None |
| A0A6G1GQS4 | 5-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.