DPCstruct | MC7264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 9.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01988 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8C9S1 | 1-114 | MRIEHCLPPPSPHRALASAITIASAYFLGGLVPLVPYFFVEEVERGLWVSVGVMAVALWVFGWVKTGVCGGDQWERVKGGGEMVVVG… |
| A0A4D9AQ88 | 73-165 | LEKPDPKTAMQSAMTIAIAYIVGGMVPLFPYMLISNADRAVIASVIVTLIALLIFGYGKGHFTGSKPFWSALQTTFIGAIASAAAFA… |
| A0A370TXF0 | 496-607 | None |
| A0A2P7YGF2 | 1-103 | None |
| A0A1C7MIN5 | 103-202 | None |
| A0A1F5IKL1 | 5-91 | None |
| A0A4U0VR80 | 322-425 | None |
| A0A4S8M1I1 | 51-163 | None |
| I3S234 | 19-110 | None |
| A0A5B0QFP0 | 139-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.