DPCstruct | MC7263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 200 ± 28 aa |
| Standard deviation of domain lengths | 28.33 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A168H838 | 1-177 | MPFQHPFQESQFDLFDWYPKFRECQSHFVEHAQHSGPVQAVAAFVNILLPFQKAQKNEREPSDNTESAASLVALVPYIRRLVATGFD… |
| A0A1B8C9Q6 | 4-193 | TESSFDPHEWHRHFQNCRRFFLDHSQHSPFLQAVAAYVNILLPYQRHPNPISAYSPPRSTTTHSGNSTPSTLSARLDDRHGESVSLV… |
| A0A132B9N8 | 103-251 | None |
| A0A1Y6LY44 | 37-298 | None |
| R1GPT4 | 17-223 | None |
| A0A842ZCP8 | 1-155 | None |
| A0A6P8BAC4 | 1-178 | None |
| A0A1Y2DZ29 | 54-235 | None |
| A0A2S7PCV6 | 35-251 | None |
| A0A2V1BI53 | 13-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.