DPCstruct | MC7259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 313 ± 29 aa |
| Standard deviation of domain lengths | 29.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8DKV1 | 5-281 | DDWQSSQAEKSTNNTDDKNDHLQDINEYNSDGNTLASAAAAVSGIPPKDPLNLSNDEYYAIRSGALALGGLARCGPLQHSTPAVELW… |
| A0A1B8BVV2 | 1-304 | MELHPAKRQKTSKWKEIDILKTPSFAVPSFDDFGRATARVAKRVMLDLNDPHLLVDVHQPNQTDRQLRLGGSFKRGGSGNVSKSLSQ… |
| A7RJC0 | 1-338 | None |
| A0A7R9JHT1 | 172-518 | None |
| A0A060X326 | 481-812 | None |
| A0A813YD58 | 15-327 | None |
| A0A4Z2AYJ9 | 179-505 | None |
| A0A4Y2LWS0 | 180-511 | None |
| A0A7R9KSS5 | 248-565 | None |
| A0A183HE48 | 1-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.