DPCstruct | MC7257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 135 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8FBR9 | 1-119 | MTWIRAISAAILSILMPGAGHVLLRDWARVILFGGLYALGVYFFVPMELLMSAESMGAMMETMEAETSMVDQFFLMFIVLFATVDST… |
| A0A2R6EF58 | 1-134 | MSARTDKRPWLAVLLAFVYPGLGHIYLREWLRALVWFFLVVTSSTLLIPETAVPETLSVEAFVAAAEAIPPEAGIALVSITAFSMAD… |
| A0A7D5K326 | 2-141 | None |
| A0A6B0SZN6 | 4-125 | None |
| A0A830EJF2 | 3-139 | None |
| L9WRV5 | 1-130 | None |
| A0A498G8I4 | 1-155 | None |
| A0A3N6N5U5 | 1-135 | None |
| A0A2R4X3M3 | 2-120 | None |
| A0A2A2FC12 | 1-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.