DPCstruct | MC7256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 239 ± 36 aa |
| Standard deviation of domain lengths | 36.09 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 18.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0WA82 | 728-952 | HAETSLVSSIPSTATSTYMIINGADGYHGVLSYGVSYDLGDGSVSLGEERASSGYSDIDYDYSWWSEHLEDEDKETSYAGGELPGES… |
| A0A1F6H4G3 | 128-366 | YDFGAGLASRQSPPDNFGWVVGGSFPAPLNTQLSRKTSYSYIYSKARQGGLTPIALETICSDLGNCDLAVAITNGTFTHGLYNASGN… |
| A0A5C7KTR1 | 917-1199 | None |
| A0A1F4ZSD9 | 872-1023 | None |
| A0A1F7GUM2 | 343-602 | None |
| A0A1G1WRI5 | 353-560 | None |
| A0A2H0WZQ4 | 2-145 | None |
| A0A0G0LCG8 | 630-860 | None |
| A0A399ZVP9 | 2-236 | None |
| A0A1J5IF35 | 292-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.