DPCstruct | MC7255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 197 ± 21 aa |
| Standard deviation of domain lengths | 21.17 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4NQ32 | 1-184 | MRHKFIFQVGFGLVSISSLLNFAPVSLAGDTIIRGAAIDSSFAPVNPGIATPNPGIVFQGDNIIVTDQVQSGLNKSINEIFNSNQNQ… |
| A0A7W1WC44 | 125-293 | TATTATSAVPDIQLQISAANVELTSPGATITNNATGSGVVINLTPESQTKLNLAATNFIPTVTSTEGTVASVITQGSGTAANTLVSN… |
| A0A1S1ZTU6 | 1-218 | None |
| A0A1B7V0R1 | 72-246 | None |
| K9TS82 | 137-327 | None |
| A0A7C3VMT1 | 31-245 | None |
| A0A3S5K2J6 | 1-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.