DPCstruct | MC7254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 236 ± 48 aa |
| Standard deviation of domain lengths | 48.36 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 69.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.49 |
| Pfam Score | 98.72 |
| Assigned Pfam label(s) | PF07765- PF08084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4DU09 | 1-196 | MDAKVKAMIKLIDEDTDSFARRAEMYYKKWPKLMKLVKEFYRAYRALAERYDHTTGELRQADRTMAEVFPNQVPYVLFGNSPSGSSA… |
| A0A2G9GID2 | 11-291 | MKRAEPKKSHSSWWDSLISPKNSKWLQENLEEMDQHVKRMLKLIEEDADSFAKKAELYFKKRPELISLVEEFYQIYRSLAERYDHVT… |
| B9FAA7 | 1-240 | None |
| A0A7N0UMF5 | 10-212 | None |
| M7Z126 | 216-457 | None |
| A0A200R3P8 | 1-255 | None |
| F6GUA8 | 138-487 | None |
| A0A166CEM3 | 2-218 | None |
| A0A2K2DJY7 | 85-336 | None |
| A0A7J9FKH6 | 1-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.