DPCstruct | MC7253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 10.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13947 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444XV63 | 12-117 | AHSIRQANGNHENCPSSFTCGNFGTFQYPFTMAEHPECGLLPIQGCLLNATSPKLIQLGNNSKSVNLTAVVETNKIITIYDDGFHTS… |
| A0A2G9G706 | 1-92 | MNLAKCFILFSLFHYLIIYTADSKCQESFRCGNLGLLEFPLSQVLQPECGLFLVDCKSSSPRIQLEYGGTWYDILEKLSANRFRIRD… |
| A0A540M6L5 | 6-108 | None |
| A0A4S4E5M8 | 284-377 | None |
| A0A6J1BKQ6 | 1-111 | None |
| A0A3P6F8E8 | 1-117 | None |
| A0A6S7MJF7 | 2-120 | None |
| A0A6P6FZU4 | 1-107 | None |
| A0A4S4EA07 | 7-111 | None |
| A0A1U8FET6 | 12-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.