DPCstruct | MC7252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 269 ± 55 aa |
| Standard deviation of domain lengths | 55.04 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08519 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9G6R1 | 33-322 | KDDNGMKRMSLLARAAESIADGDIVNVQIRRYRQWQLSQIGSLASCIIPAALLHGQRETLEQGERNFNRFGGWLGKNSTMGKNYRLL… |
| A0A423T1N1 | 72-290 | FSEADHKTMSLYDKSDLFFHDYSIAPLFVQENYPKAVPHIAKGNRRVTLEQLAKTAGSLADGDLVEKAIRSKNAWSLLPTQAMFSSV… |
| A0A1E7FUA3 | 229-449 | None |
| F6HCZ5 | 20-319 | None |
| H0EEQ6 | 173-507 | None |
| A0A287XBK5 | 89-405 | None |
| A0A4V5N876 | 2-158 | None |
| A0A183TQ44 | 2-316 | None |
| A0A2C5ZX55 | 14-436 | None |
| A0A0B1PPI8 | 8-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.