DPCstruct | MC7249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 99 ± 15 aa |
| Standard deviation of domain lengths | 14.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0435 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9WG76 | 3-71 | DKSIQEDCLLFVTKPGQKRASLRDVFQLYCGLSPGTTVRDLCSRYSQQLQRVDERKLIQFGLMKGLIRR |
| A0A7R9IU88 | 25-112 | IFQYSNVYSVTPKIKMLSIDKELQQRCIKFVSKSVRQPPVLRDIFRMYSGMTYGTSIRDLCVRLNPHPLRINERKLVQFGMLEGLIRR |
| A0A3P6SAM3 | 1-128 | None |
| A0A1J1IZL3 | 410-495 | None |
| A0A7R8WMH3 | 365-451 | None |
| A0A7R9UQ05 | 63-177 | None |
| A0A1X7UNZ3 | 150-236 | None |
| A0A1S8W960 | 523-621 | None |
| A0A015LET4 | 170-280 | None |
| A0A6J2KBE1 | 6-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.