DPCstruct | MC7248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 131 ± 20 aa |
| Standard deviation of domain lengths | 19.78 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K3DGQ8 | 135-261 | LRHPVVGLEPALGPELCGRLGEVVRKMGGSVAAAPDDAKVTHRVCVPPPGVSDAGRVKPQAMRCLEVRGDMACVHWTQLPDSYDEWV… |
| A0A1S4EKR2 | 139-270 | LVMPNVFIRSDVEKSVQSKVKEIIKRHQGTVSETEEDVTHVIYPVVDPLDEEYARAVYRRPSHTLLHWYYFPDSHDSWDPIEISTVE… |
| A0A7S1PGU9 | 158-268 | None |
| A0A0D2NUX5 | 158-267 | None |
| A0A817QC83 | 28-143 | None |
| A0A1I8I236 | 139-267 | None |
| A0A066VNE7 | 226-359 | None |
| A0A830HP99 | 135-260 | None |
| A0A4Z2BD06 | 66-205 | None |
| A0A7R8CB21 | 38-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.