DPCstruct | MC7247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 151 ± 15 aa |
| Standard deviation of domain lengths | 15.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8AE74 | 692-837 | EADEALADQALLGDVFLFMKEGMLGCESFRQEEFYIRRLHSLITDFLALMPMKVKQLRNRADEDARLVHMSLQMDSELPSSLRKDLD… |
| A0A5B7FR51 | 318-457 | LEEEDVILNEALKGKVFSFIQNSILTKKNTPLDTFYCQRLHGILSDFIVNAPERVKAMKNRADENSRLITANLRESLEPPTNLDQPF… |
| T1FPE9 | 308-469 | None |
| A0A2G8L4V0 | 397-564 | None |
| A0A6J8DB64 | 355-494 | None |
| A0A0S7GFA6 | 177-344 | None |
| A0A7R9DC13 | 366-540 | None |
| A0A822CT89 | 7-146 | None |
| A0A3S2P554 | 320-439 | None |
| A0A811WAU3 | 40-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.