DPCstruct | MC7244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Standard deviation of domain lengths | 17.47 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9IMU3 | 1-121 | MLRPAIVHCPRDPPIIRPSLPPPLKAAMPAPFRPPASYSLTFIEDINYPRLWSETHVAHWLYWAIREFSLEGVPLNQFHMRGKDICA… |
| C3YCW3 | 6-113 | TSREKSADDVMSERPTRRPVQVHTVTSLMTLQIPLDPLSWDLRDVRTWLRHLAARHQITVDLRLFHMNGRGMCLMNLQGFEYRVPVN… |
| A0A7E5X234 | 1-134 | None |
| A0A6P8HJW8 | 1-130 | None |
| A0A7M5V127 | 220-340 | None |
| A0A6I9YR22 | 23-142 | None |
| A0A821VS52 | 1-142 | None |
| Q17H53 | 1-124 | None |
| A0A6P7FHE6 | 1-110 | None |
| K1PN04 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.