DPCstruct | MC7241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 206 ± 42 aa |
| Standard deviation of domain lengths | 42.45 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10232 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3CB34 | 7-168 | QREEKQLEATLQAILNKVNDLKGAIQALITKLETEHETINWPTFLDNYAILSGHLTGLSKILQAELASSLRSRIVLPLQLSCERDEA… |
| A0A7R9IGB4 | 2-221 | QREEKQLDSALEAVISQVNTLKNSIASLLVKLEQQYETLSWPNVLSSFAMMSSDLTNLSKLMSHDKAPPLRNLTLLPLELSPNRDDE… |
| A0A445HS81 | 1-254 | None |
| A0A226ELQ1 | 2-208 | None |
| A0A6A5Y8Q7 | 6-268 | None |
| A0A7R9AA01 | 39-261 | None |
| A0A4S2N4K7 | 2-210 | None |
| A0A2K3P282 | 1-255 | None |
| A0A3N4LFE5 | 42-310 | None |
| A0A7D9DEJ3 | 3-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.