DPCstruct | MC7239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 167 ± 15 aa |
| Standard deviation of domain lengths | 14.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9IEH6 | 160-328 | GKGACFRAHLNSLWSVWYGLCATGLQGYIALQCVRRFLNYVELPWPVGKTPPRLELHACLGLTGAAILLLPFFLTSALLKIGNLAND… |
| A0A817TNL6 | 1-142 | MARTELISLSRIWYTIIVVLIQLILVFFGIKQCYYNDRLPWPISASSPKYELLIQKICLLISLVLLLIFIYPALFKIGNFSNDNEQL… |
| A0A6V7Y003 | 9-185 | None |
| F4WJJ5 | 62-210 | None |
| A0A1I8BXC2 | 7-193 | None |
| A0A6A4VCK0 | 27-187 | None |
| A0A6J0CD31 | 55-210 | None |
| A0A6A4KIH4 | 299-476 | None |
| A0A7R9KMP2 | 19-171 | None |
| A0A6P7VZQ8 | 9-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.