DPCstruct | MC7238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 395 ± 64 aa |
| Standard deviation of domain lengths | 64.46 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0S297 | 4-351 | PFAGSMMYEVYKLMPNDTDFTIFKNQGFSGFNVALVQGFVNYHSATDKPENLDLASVQHMGNYVMGVTKHFGNLSLESTKSADLVYF… |
| A0A7R9IE41 | 168-481 | KEILFQAGPNHPWLVKLYVESVPHPNALVLAEDIFQSDLIPSDTDFRVFRDFGNIPGLDFAHAMNGYVYHTKYDNMDAIPRGTVQHT… |
| A0A6P4E7E1 | 5-294 | None |
| A0A7G9FG84 | 31-568 | None |
| A0A814TME5 | 1-389 | None |
| A0A539D9L6 | 4-432 | None |
| A0A556TUA6 | 189-476 | None |
| A0A0K6G744 | 539-992 | None |
| A0A507E6Q0 | 209-621 | None |
| A0A6P4E8E7 | 6-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.