DPCstruct | MC7236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Standard deviation of domain lengths | 10.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3LA40 | 10-106 | TREEKLKACAAKIIAKETFAPGDLVIWKEGMKNRRFPAYAEAVVVTQVLAEPVIDNTERSSGTPTFREPLDVVIGWLDSDGDFIEFY… |
| A0A846HLQ8 | 9-107 | LGSVLQERFALLNQRHSFKPGDLVCWKPGLKNRRVPAYGNPAVVLEVLEAPITDGETESGSTYFREPLSLVLGLFWDREPGRGDFVA… |
| A0A752KBM7 | 4-114 | None |
| A0A0J6SLI5 | 19-126 | None |
| A7BY52 | 7-120 | None |
| A0A8B3IZT9 | 103-193 | None |
| A0A0M3DBB7 | 42-151 | None |
| A7BS22 | 17-128 | None |
| A0A2P2DIE9 | 40-131 | None |
| A0A5Q2W2M8 | 4-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.