DPCstruct | MC7232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 188 ± 18 aa |
| Standard deviation of domain lengths | 18.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A202DYJ0 | 476-646 | SAETITSNSSSFNSISINGSGGDFVIEDTLDINGDLTISAGSTLDAHNTESNSITLTGDWTNAGTFLARSGTVTLDATHHTIGGITT… |
| A0A1Y0EQ60 | 7-193 | ADLQVDGALHAQTVELADVDNLAVGAAGVLDGGSARIALGGDVSQSGTLIPGSSTVAITDTCGNTESRVSGNATFHDLSVISTAGKK… |
| A0A2J0Q6J3 | 345-545 | None |
| A0A7X6UMK7 | 334-531 | None |
| A0A7X6UMQ1 | 151-331 | None |
| A0A7X6UPM4 | 405-550 | None |
| A0A7C0ULU3 | 563-751 | None |
| A0A7X6ZFS2 | 7-211 | None |
| A0A6G8C275 | 12-223 | None |
| A0A554M5Y5 | 354-557 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.