DPCstruct | MC7231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 161 ± 17 aa |
| Standard deviation of domain lengths | 16.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8NRW4 | 242-385 | RESVQRIAPDPITLIPPLVRGDAEYSGNGPEIFVRLVLTQMADRIDATITMRAEETESDWTTADGTITRTIFQPPSGWAIQALVGET… |
| A0A1Y0ELR7 | 1-164 | MSKIIDFFPQTEVRIARLNHVSGGDADIFSKSGRSTHVYVRAFTPVPVRSSTAVQCLVEYSVEEGRSNNTRLLGRTTVTMELENGMR… |
| A0A7T9IEQ0 | 258-412 | None |
| A0A5B7SXD0 | 16-196 | None |
| A0A7L7L8M7 | 673-843 | None |
| A0A6P0MPH9 | 3-155 | None |
| A0A4V1A451 | 60-239 | None |
| A0A849ZI74 | 317-454 | None |
| A0A3N5TCR6 | 81-241 | None |
| A0A1H5YGN7 | 27-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.