DPCstruct | MC723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 232 ± 31 aa |
| Standard deviation of domain lengths | 31.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1ZSV8 | 429-676 | YWTDKFCILRTWDRAPRLGTQVTMNAKAFIMLTIIAFAVVSSFYVASFPFDNACEDESAVPSEYVGTWTIRVGDGSTATAVVEEGDD… |
| A0A7S1B373 | 7-232 | CLLRIFQPAPKMGKFLSKIIESFFFGIITLYILNLAYTFSGFPFDNVCEENSTISANYMEDHELTTLQNKTFSIFVEDGDKTYKFCN… |
| A0A7R9WLA2 | 39-298 | None |
| A0A7S1GL09 | 4-246 | None |
| A0A7S0C6S6 | 87-333 | None |
| A0A7S0GLN7 | 1-162 | None |
| A0A7S2DXK8 | 2-237 | None |
| A0A7S1UQA4 | 28-298 | None |
| A0A7S1ZFN4 | 20-256 | None |
| A0A835YVZ1 | 594-857 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.