DPCstruct | MC7229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 205 ± 26 aa |
| Standard deviation of domain lengths | 26.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.76 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF09338- PF07355 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P8WM07 | 333-512 | KKTGRPRVVLVKEIMGQGAMHDNVLCPIEPAGVHGGCMNVDLGNVPVMLTPNQVRDGAIHALTCIGPATKEMTRHYFREPLVEGLAE… |
| A0A2V6WS46 | 8-233 | LPRVAYVFQIHSHQRPTGLDEGILYGDPVRRMLPTVVHPNEVLDGAVLRGFMGRSVTTWATQNHPMIRALYAQHGRTLWFAGVVLTV… |
| A0A645CCV0 | 19-201 | None |
| A0A2V7HQ99 | 448-675 | None |
| A0A1B2I777 | 201-439 | None |
| T0D0I3 | 158-317 | None |
| A0A7C6VC40 | 196-373 | None |
| A0A4R2JAT4 | 192-370 | None |
| A0A7Y8VS03 | 257-432 | None |
| A0A428MVH1 | 321-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.