DPCstruct | MC7227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 180 |
|---|---|
| Mean domain length (aa) | 222 ± 28 aa |
| Standard deviation of domain lengths | 28.17 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.59 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF11824- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8EGT8 | 133-351 | VYSNEVSASVIAFRAGASAGAPSGTLSLTINKPSGTVEGDVMIASIAVRPDTAAITEPADWALVRRVDNANPNANSLAVYYKVAGAS… |
| A0A0S8DQI0 | 65-281 | GSLTIGSIASASASGGNSTLSATGVNLSGQNAVIVFVSINNNSDQFVSSVIIDPGGANVTVPYLADSNNLQSGGNDARIYVYGMANP… |
| A0A0N0JZX0 | 3-252 | None |
| A0A7X0G6Q9 | 833-1044 | None |
| A0A0L0LLU9 | 414-629 | None |
| A0A7X7IJV3 | 2-253 | None |
| A0A6G8FVX1 | 11-240 | None |
| A0A838UN77 | 67-291 | None |
| A0A1G1G0Z8 | 35-274 | None |
| A0A536RH86 | 331-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.