DPCstruct | MC7223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 506 ± 94 aa |
| Standard deviation of domain lengths | 94.14 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09766 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6MC20 | 7-502 | PLKAKQRVDVLHLQLQNLLYEVMHLQKEIGKCLEFRSQHEEIELVSEEEFFQEAPAEISRPHVTRDDQHQLTLARLDWELEQRKRLA… |
| A0A1V4JSN8 | 348-863 | EECEVDLRDPIKDYELYRDTCQELQRLMAEIQELKSRGIKDNASEIDERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHEAKQKVDA… |
| A0A817U906 | 2-449 | None |
| A0A507DCT3 | 24-593 | None |
| A0A5J4NGI0 | 29-563 | None |
| A0A507FFT0 | 106-696 | None |
| A0A0V0J2H1 | 3-554 | None |
| A0A183NRZ9 | 4-430 | None |
| A0A0C2J6X4 | 22-532 | None |
| A0A1E7FL90 | 9-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.