DPCstruct | MC7221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 5.86 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812V3T2 | 223-282 | KRYKVDGRWHTWIDYDRFHELVKAGVEFDATDYWAPTPEWALYGSEEAGFDPNETRVYHN |
| A0A1V4JNE2 | 1-76 | MKFGSETFKVDGDWFTWIDYGRFQELVQEHERSSGAKTFTAADYTARTPEWALFGSRERGFDPLDVRYQRKNKARD |
| A0A7S1XQM9 | 357-426 | None |
| A0A0C2ICF2 | 304-370 | None |
| A0A7J6LW53 | 533-617 | None |
| A0A2K6F240 | 544-614 | None |
| A0A7S0UK86 | 310-375 | None |
| A0A8B6CN86 | 1-74 | None |
| A0A7G2CQA7 | 126-193 | None |
| W7T963 | 165-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.