DPCstruct | MC7220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 504 ± 80 aa |
| Standard deviation of domain lengths | 79.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.57 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0409- CL0220- CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6B9V5 | 191-783 | FVTAYEELPLGTFVVQGKDFDTEAVDAVAKVNAAGNVVTLWNALQSKYFTGATEANIQGYFDSIAADAPGTVADINKIIADVNKASE… |
| A0A1V4JIC9 | 25-574 | FHLGHPQKAIGHYKEALTLLSHCQDTPRSARERVVHKLTDAIQHQLCLHGRLSHQGGWAPTLQLVHHGPSHPPPSLSPPVHAAVLAI… |
| A0A4D9EYU0 | 123-588 | None |
| A0A1I7WK55 | 127-547 | None |
| A0A2P8H3K8 | 381-880 | None |
| A0A2P8YBS7 | 1-650 | None |
| A0A7F8RRR2 | 32-492 | None |
| A0A0S7JK32 | 4-461 | None |
| A0A423SC53 | 2-489 | None |
| A0A6S7JH85 | 3-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.