DPCstruct | MC7219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 146 ± 11 aa |
| Standard deviation of domain lengths | 11.19 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00786 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482X4P1 | 1-125 | MSDDEDKPPAPPVRLTSNRGDTTPNLPVDMRPLPKEPDSDERKKKAGKNKTRTKGRETEKPNISYPTNFEHTVHVGFDAVTGEFTGM… |
| A0A1V4J6U7 | 1-136 | MIGSGSKDAATLNHGSKPLPPNPEEKKKKDRYFRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQT… |
| A0A7J8H3P0 | 1-154 | None |
| A0A7J7IUI4 | 2-145 | None |
| A0A5K3EY90 | 42-193 | None |
| A0A0V0XQB8 | 1-158 | None |
| A0A1S8X0R3 | 14-176 | None |
| A0A4Y2N6N4 | 41-189 | None |
| A0A183A8M0 | 1-144 | None |
| A0A1Y3AY71 | 35-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.