DPCstruct | MC7218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 159 ± 52 aa |
| Standard deviation of domain lengths | 52.38 |
| Length coefficient of variation | 0.33 |
| Mean AlphaFold2 pLDDT confidence score | 75.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.40 |
| Pfam Score | 88.83 |
| Assigned Pfam label(s) | CL0123- PF07303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1PPW7 | 1-113 | KYPPVSSERERSCYAAVFQDQYSEFLELQQELRSAQAKLQHLEALLTSLPPPQSQKEAQVAARVWREFEKKRTDPGFLDKQARCRYL… |
| A0A1V4J5J3 | 255-394 | VERKPELLNGHIPAGHIPKPIVMPDYLAKYPAIQTNEMRDRYKAVFNDQFAEYKELSVEVHAVLKKFDELDTLMRQLPHHPESIYEQ… |
| K7FJS0 | 172-316 | None |
| A0A2K5PIK0 | 321-486 | None |
| A0A1S3WP20 | 18-222 | None |
| S7N1Y2 | 240-372 | None |
| A0A811KMS5 | 125-345 | None |
| A0A3B5M5R9 | 68-430 | None |
| A0A6I9K664 | 72-267 | None |
| A0A821GN94 | 85-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.