DPCstruct | MC7216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 110 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0644 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1L539 | 1-107 | MPSWIGAVILPLSGLLLSLPARAEVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLV… |
| A0A1V4J466 | 9-134 | LRLGVLLLATASGDAEAPPSCEGVRKVFQLRQLGPLRGIPESPRAGADLQVCTSEKLTCCTKKMEERYQTAAKQDIQQVLQTSSATL… |
| A0A5E4CF48 | 14-112 | None |
| E9G9V6 | 25-126 | None |
| A0A4U5UDL8 | 88-200 | None |
| A0A3M0JMZ9 | 1-111 | None |
| A0A3M0KLS1 | 4-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.