DPCstruct | MC7214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 75 ± 4 aa |
| Standard deviation of domain lengths | 4.41 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 68.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7F9Z7 | 154-228 | SSVLDIWIPQPFHAEVPADWWDTEADKSLLIGVFKHGYEKYNSMRADPALCFLERVGMPDAKAIAAEQRGSDMMA |
| A0A3B5LLF6 | 214-287 | DIRDVDIWMPEMEQQEVPAGWWDSDADRSLLAGVFKHGYEMYTTMRADPCLCFVERVGRPDDKAIDAEQHTGDA |
| A0A437CG93 | 298-376 | None |
| A0A060WU78 | 1-74 | None |
| A0A2I0T7X0 | 146-221 | None |
| W5LYB8 | 1-84 | None |
| A0A3Q2UBD7 | 543-611 | None |
| A0A7R9H346 | 986-1053 | None |
| A0A7J7SAM1 | 23-94 | None |
| A0A2K6U807 | 23-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.