DPCstruct | MC7212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 109 ± 15 aa |
| Standard deviation of domain lengths | 15.36 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1WTW8 | 5-101 | MTFDELMKRWTWQPLPRCPGRYKLVGVDRFTSLSQLLGSGVPIYRFRVAAARDLVLVAALDRGGLISYQRADGSFVHTLNTPEGFAR… |
| A0A356KH12 | 10-104 | PTYAALLEVGEWREIPGCPGRSLLPGVRQASPRDLLGERATITRHEVEGAPDPVHVAAVRGGGLISYEKAEGWVHTLNTPEGFLRKL… |
| A0A2P4YL29 | 9-141 | None |
| A0A485KMI4 | 19-144 | None |
| A0A812XSD5 | 12-110 | None |
| A0A356AA96 | 13-110 | None |
| A0A518DHJ9 | 28-124 | None |
| A0A517RLT6 | 56-153 | None |
| B8C983 | 21-136 | None |
| A0A6G0WYS0 | 10-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.