DPCstruct | MC721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 13.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0BXF5 | 5-107 | RNLFNKIVKLNSEGMAEAGCDYKYYYVLTYLPDLQWVHLGPLVTNGFFGDDKPKANGRSKWALVPESENKEVDLTANYCTIVKQVRA… |
| A0A6U5H8L7 | 30-162 | TKTAALTAGDIGSTDLALAPTAKVAKVDKKFKNLFNKVVKLNPAGIKEAGNEYKYFYVLTYLPDLQWVQLGPLVKNGVFGSEKSSVE… |
| B7FPY9 | 738-867 | None |
| A0A7S3DY46 | 1-122 | None |
| A0A7S2ESE3 | 356-503 | None |
| A0A830HI38 | 981-1089 | None |
| A0A7S2W7Y3 | 261-384 | None |
| K0RFL9 | 572-678 | None |
| A0A7S1D6I7 | 323-449 | None |
| A0A7S3ZCB2 | 524-650 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.