DPCstruct | MC7207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 8.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821SXB4 | 4-84 | GPVLFRSHLLTTWIWLLIAVAGTINHHCGYLIPGILSTGLANPSFHDFHHSHFTANFGLLGILDRLHGTDKAWRAHKQKTE |
| A0A6P5AIT6 | 9-114 | QQEADRATAEATGPILMGSHLVTVWLWFCLSLTATSISHSGYHFPLLPSPEAHNFHHVKFNQCYGVMGVLDRLHGTDEQFRHNKAYD… |
| A0A0B1T759 | 7-109 | None |
| A0A182XUZ5 | 1047-1140 | None |
| A0A4Y2IXP1 | 1-88 | None |
| A0A3M0J8U6 | 738-835 | None |
| L8GRS8 | 2-82 | None |
| A0A6L5CT46 | 795-892 | None |
| A0A833YV67 | 43-155 | None |
| A0A3Q3K7Y2 | 131-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.