DPCstruct | MC7204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 308 |
|---|---|
| Mean domain length (aa) | 179 ± 32 aa |
| Standard deviation of domain lengths | 32.05 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.42 |
| Pfam Score | 99.01 |
| Assigned Pfam label(s) | PF03798- PF03167- PF04117- PF11955 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5A5K3 | 4-173 | LWRGYVRLAQVYPFRTQVGTTGVLFLVGDAIAQFGVERRTFQNYDYARTARMSAVGLLWVGPVLRTWLVTLERLVVSTGPTAALKKM… |
| A0A7X0S2P1 | 10-219 | FILILIISFLAYPVTRETFLTLTKSHPYILGFIKVSILATMGEFLSIRICTGDFKKPKGLLYKFLVWGFIGMIFVIMFDIFSGGVSY… |
| A0A0G4H952 | 2-249 | None |
| A0A1Y2HPZ2 | 3-204 | None |
| A0A1B0BZ08 | 258-448 | None |
| A0A6I9YTS0 | 2-128 | None |
| A0A821LWN6 | 2-122 | None |
| A0A162K4Q9 | 37-248 | None |
| A0A7S3ZXF3 | 149-345 | None |
| A0A2H6HWM3 | 3-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.