DPCstruct | MC7203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 255 ± 28 aa |
| Standard deviation of domain lengths | 27.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5A2H7 | 1-293 | MDDKDSFKKRLEEETDEVKTTSYFYLQSNEARFRPENVSEEQRKQQLQKTLGLMVYSQTDRKAYQHVFSKRIEDFTAAGELDLKKEK… |
| A0A369RWF4 | 347-576 | IGLMLYSRTENEFLKTYLSARDGCQPPLPPRTKLSIAREKIRQKQQIMMRDHSKVVKAIERFLKVLAESNIDEDAIIDKTELKLAFS… |
| C3ZS12 | 705-966 | None |
| A0A812C1T4 | 258-497 | None |
| V3ZUJ0 | 1-255 | None |
| C3ZJ45 | 64-334 | None |
| A0A6P5AQW8 | 1-202 | None |
| A0A6P4ZLP9 | 243-526 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.