DPCstruct | MC7202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 146 ± 20 aa |
| Standard deviation of domain lengths | 20.47 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 53.23 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0018- PF02173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4ZZS9 | 1-141 | MTNAGQGAVTAAAMPAGTTIVQYTQGDGSQQFVTVPVSISPAGEVQAYQIRAPSSLPAGVVMATPTGITSPQQLAEESARKRELRLM… |
| A0A060YAI2 | 1-143 | MQGMQTLTMTNAAGAQQGTTILQYAQTSDGQQILVPSNQVVMQAASGEVQTYQIRTANTSSMTPGMVMASSPALSGQEGPEVVVTRK… |
| A0A1S3WW12 | 34-152 | None |
| A0A2I0TBX5 | 20-184 | None |
| A0A813NR72 | 91-282 | None |
| A0A834ETY4 | 110-239 | None |
| F6ZS21 | 142-269 | None |
| A0A7R9G810 | 120-266 | None |
| A0A6P3J7I5 | 1-133 | None |
| A0A2G8JV43 | 68-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.