DPCstruct | MC7201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Standard deviation of domain lengths | 11.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12560 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3ZTS9 | 3-102 | VLEQQGADSLHQVKLQMYCRLCGEYKKGMSSNKFRFQADLQRYLMVDVCTDAPSIHPGKICTGCMAYLKRLKVYYRRTRSLKEPRKT… |
| A0A6P4ZY54 | 7-118 | IDSHIENINRLCRFCGEFNLTKAEKDKKLSALNCELYAPKIKEIWGIEVARDRPYLHPKFFCRKCRSRLYNPPKLSRAKRISWYPHT… |
| A0A2B4SE66 | 1-123 | None |
| A7RIP0 | 3-126 | None |
| A0A6P4YNJ9 | 1-129 | None |
| A0A8B6FAW9 | 16-134 | None |
| A0A7M7N2J8 | 18-136 | None |
| A0A7M5UGP1 | 1-98 | None |
| A0A7M5WSY0 | 2-112 | None |
| A0A1X7U4H6 | 1-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.