DPCstruct | MC7200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 99 ± 4 aa |
| Standard deviation of domain lengths | 3.84 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A290H9Y0 | 5-96 | DIKFSLWCDFVERSFLEGEFGDLIEKKIVNAATSNPSIFKSAFLGSPAYAEDKAKLHGKSAKEMYEALAIGDIQRAAKKLLPLYEKD… |
| A0A7H0GV91 | 1-105 | MNPLVAIRQFDQSIWLDFIRRKILINGELQRRITDEALRGVTSNPAIFEKAIGGSDDYDAAIESLALQNKSADEIYTELAIADVQHA… |
| A0A645G668 | 1-98 | None |
| A0A538C9K4 | 33-131 | None |
| A0A7T8A3N6 | 1-98 | None |
| A0A534W212 | 1-97 | None |
| A0A4R5DJC1 | 1-101 | None |
| A0A0K1EKM9 | 697-793 | None |
| A0A1F8PTI6 | 1-100 | None |
| A0A370BBM8 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.