DPCstruct | MC720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 135 ± 13 aa |
| Standard deviation of domain lengths | 13.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6YUT1 | 390-515 | LVGQVFPGPRPKPDPYSAEPLKGSWASPGPKAGPFETVLADGSTVRYHWYRFIDQPCFQQFDWTPTQRNALQRIIVKMHRHWKIDDQ… |
| A0A7S4R5X4 | 85-220 | LQFQRFPRKSSIWPFKGPYDALSKAPAGGCLSHPGPADPTLYCARTSSPSWIAYRWYRFVDQPGLRRANLGAAERQFLQARVEQLHE… |
| A0A517NYM5 | 417-567 | None |
| A0A7C6AIP3 | 7-138 | None |
| A0A7S3ALZ2 | 250-392 | None |
| A0A7S0CJF4 | 15-158 | None |
| A0A6L8LBQ5 | 707-843 | None |
| R1DAD4 | 483-597 | None |
| A0A7V3T2W0 | 171-302 | None |
| A0A6C2TVN9 | 891-1025 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.