DPCstruct | MC72
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 109 ± 17 aa |
| Standard deviation of domain lengths | 16.78 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847MVS5 | 2-102 | KSGTVAPLTVDGRMGPASRKAFQQLCGLTGSQVDGKLSPSFWKAAQRWAGLSGADIDGSCGPRTRDAIARKTGHTELLGAKWAWDSD… |
| A0A2T9XMH0 | 2-80 | DGIWGDLTTKALQRALGVTDDGIIGPITRKALQRRIGVTADGIWGPITHKALQRHLGVTADGIWGPITVKALQDRLNAG |
| A0A7I0DMC0 | 137-227 | None |
| A0A0R2DWK2 | 232-341 | None |
| S4MLM6 | 533-629 | None |
| A0A7T9WF03 | 73-192 | None |
| A0A7K2J086 | 1-102 | None |
| A0A358IVG8 | 4-111 | None |
| A0A358IVF5 | 15-121 | None |
| A0A6I5X9C7 | 339-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.